|
If you can't view the Datasheet, Please click here to try to view without PDF Reader . |
|
Datasheet File OCR Text: |
?f2012fsemtechfcorporation 1 SC461 ecospeed ? dc-dc buck controller with integrated ldo features powerfsystem inputfvoltageff3vftof28v integratedfbootstrapfswitch fixedf5vfldofoutputff200ma 1%freferenceftolerancef f -40ftof+85fc selectablefinternal/externalfbiasfpowerfsupply ecospeed ? farchitecturefwithfpseudo-fxedffre - quencyfadaptivefon-timefcontrol logicfinputfandfoutputfcontrolf independentf enablef controlsf forf ldof andf switcherf programmablefsoft-startftime programmablefv in fuvlofthreshold powerfgoodfoutput selectablefp ower-savefmode protections automaticfrestartfonffaultfshutdownf over-voltagefandfunder-voltage tcfcompensatedfr ds(on)f fsensedfcurrentflimit thermalfshutdown smartfpower-save pre-biasfstart-up capacitorftypes:ffsp,fposcap,foscon,fandfceramic f package ff3fxf3(mm),f20-pinfmlpqf lead-freefandfhalogen-free rohsfandfweeefcompliant applications ofcefautomationfandfcomputing networkingfandftelecommunicationfequipment point-of-loadfpowerfsuppliesfandfmodulefreplacement ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? description thefSC461fisfafsynchronousfecospeed ? f buckfregulatorf whichfincorporatesfsemtechsfadvanced,fpatentedfadap - tivef on-timef controlf architecturef tof providef excellentf light-loadfefciencyfandffastftransientfresponse.ffitffea - turesfanfintegratedfbootstrapfswitchfandfaffxedf5vfldofinf af3fxf3(mm)fpackage.ffthefdevicefisfhighlyfefcientfandf usesfminimalfpcbfarea.ff thefSC461fsupportsfusingfstandardfcapacitorftypesfsuchfasf electrolyticforfspecialfpolymer,finfadditionftofceramic,fatfswitch - ingffrequenciesfupftof1mhz.fthefprogrammableffrequency,f synchronousf operation,f andf programmablef power-savef providefhighfefciencyfoperationfoverfafwidefloadfrange.f additionalffeaturesfincludefcycle-by-cyclefcurrentflimit,f programmablefsoft-start,funderfandfover-voltagefprotec - tion,fprogrammablefover-currentfprotection,fstart-upfintof pre-biasedfoutput,fautomaticffaultfrecoveryf(hiccupfrestart),f soft-shutdown,fandfafselectablefpower-savefmode.ffthef devicefalsofprovidesfseparatefenablefinputsfforfthefpwmf controllerfandfldofasfwellfasfafpowerfgoodfoutputfforfthef pwmfcontroller.ffoutputfvoltagefrangefisf0.6ftof5v,fwithf outputfvoltagesfgreaterfthanf5vfsupportedfusingfadditionalf components.ff thefinputfvoltagefcanfrangeffromf3vftof28v.ffthefwidef inputfvoltagefrange,fprogrammableffrequency,fandfinte - gratedf5vfldofmakefthefdevicefextremelyffexiblefandf easyftofusefinfafbroadfrangefoffapplications.ffsupportfisf providedfforfmulti-cellfbatteryfsystemsfinfadditionftoftra - ditionalfdcfpowerfsupplyfapplications. revisionf2.0 power management typical application circuit vdda pgood en ton enl 1 f vext or vldo pgnd agnd vldo enable ldo rton sc 461 vddp vldo ss 0 . 1 f 1 f enable pgood psv psv lx ilim rlim + vout cout l 1 vout fb cin dh bst dl vin vin vext or vldo 10 n f
SC461 2 pin confguration ordering information marking information 461 yyww xxxx agnd pad 1 2 3 4 fb vldo vout vdda 5 6 7 8 9 10 d h pgnd psv dl vddp pgood 15 14 13 12 11 16 17 18 19 20 vin l x b s t n c s s i l i m t o n e n l e n a g n d top view notes: 1)f availablefinftapefandfreelfonly.ffafreelfcontainsf3000fdevices. f 2)f lead-freef packagingf only.f devicef isf weeef andf rohsf compliantf andfhalogen-free. yyww = date code xxxx = semtech lot number mlpq-ut20 device package SC461ultrt (1)(2) mlpq-ut20 SC461evb evaluationfboard SC461 3 absolute maximum ratings (1) lxftofpgndf(v) .f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f -0.3f tof +28 lxftofpgndf(v)f(transientff100ns)f f. . . . . . . . . -2.0f tof +28 dh,fbstftofpgndf(v) f. . . . . . . . . . . . . . . . . . . . . . . . -0.3f tof +35 dh,fbstftoflxf(v) f f. . . . . . . . . . . . . . . . . . . . . . . . . . . . -0.3f tof +6 dlftofpgndf(v) f. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -0.3f tof +6 vinftofpgndf(v) f. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -0.3ftof+30 en,ffb,filim,fpgoodftofagndf(v) f. . . -0.3ftof+(vddaf+f0.3) psv,ffss,ftonftofagndf(v) f. . . . . . . . . . -0.3ftof+(vddaf+f0.3) vldo,ffvoutftofagndf(v) f. . . . . . . . . . -0.3ftof+(vddaf+f0.3) tonftofagndf(v) .f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f -0.3ftof+(vddaf-1.5) enlftofagndf(v) f. . . . . . . . . . . . . . . . . . . . . . . . . . . . . f-0.3ftofvinf vddpftofpgnd,fvddaftofagndf(v)ff f. . . . . . . . . . -0.3f tof +6 vddaftofvddpf(v) f. . . . . . . . . . . . . . . . . . . . . . . . . . . ff-0.3fftoff+0.3 agndftofpgndf(v) f. . . . . . . . . . . . . . . . . . . . . . . . . . . ff-0.3fftoff+0.3f esdfprotectionflevel (1)f (kv) f. . . . . . . . . . . . . . . . . . . . . . . . . . . . f2 recommended operating conditions inputfvoltagef(v)f f. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3.0f tof 28 vddaftofagnd,fvddpftofpgndf(v) f. . . . . . . . . . . f 3.0f tof 5.5 voutftofpgndf(v) (2) f. . . . . . . . . . . . . . . . . . . . . . . . . . 0.6f tof 5.5 f supportsfoutputfvoltagesfgreaterfthanf5.5vfusingf f externalfcomponents thermal information storageftemperaturef(c) f. . . . . . . . . . . . . . . . . . . . -60ftof+150 maximumfjunctionftemperaturef(c) f. . . . . . . . . . . . . . . . f150 operatingfjunctionftemperaturef(c) f. . . . . . . . -40ftof+125 thermalfresistance,fjunctionftofambient (3) f(c/w) f. . . . . .f50 peakfirfrefowftemperaturef(c) f. . . . . . . . . . . . . . . . . . . . f 260 exceedingfthefabovefspecifcationsfmayfresultfinfpermanentfdamageftofthefdeviceforfdevicefmalfunction.ffoperationfoutsidefoffthefparametersf specifedfinfthefelectricalfcharacteristicsfsectionfisfnotfrecommended. notes: (1)f testedfaccordingftofjedecfstandardfjesd22-a114.f (2)f voutfpinfmustfnotfexceedf(vddaf+f0.3v). (3)ffffcalculatedffromfpackagefinfstillfair,fmountedftof3fxf4.5f(in),f4flayerffr4fpcbfwithfthermalfviasfunderfthefexposedfpadfperfjesd51fstandards. unlessfspecifed:fv in f=12v,fvddaf=fvddpf=f5v,ft a f=f+25cfforftyp,f-40ftof+85fcfforfminfandfmax,fft j f SC461 6 electrical characteristics (continued) parameter conditions min typ max units high-side driver (dh, bst, lx) peakfcurrent vddpf=f5v,fffdhfpinfsourcingforfsinking 2 a onfresistance r dh_pull-up, fflxff SC461 7 efciency vs. load power save mode 20 % 30 % 40 % 50 % 60 % 70 % 80 % 90 % 100 % 0 1 2 3 4 5 6 7 8 9 10 i out ( adc ) e f f ( % ) 12 v 6 v 24 v characteristicsfinfthisfsectionfarefbasedfonfusingfthefdetailedfapplicationfcircuit. efciency vs. load forced continuous mode 20 % 30 % 40 % 50 % 60 % 70 % 80 % 90 % 100 % 0 1 2 3 4 5 6 7 8 9 10 ( adc ) e f f ( % ) i out 12 v 6 v 24 v load regulation forced continuous mode 1 . 75 1 . 76 1 . 77 1 . 78 1 . 79 1 . 80 1 . 81 1 . 82 1 . 83 1 . 84 1 . 85 0 1 2 3 4 5 6 7 8 9 10 12 v 24 v 6 v v o u t ( v ) i out ( adc ) efciency vs load - 5v output i out ( adc ) 20 % 30 % 40 % 50 % 60 % 70 % 80 % 90 % 100 % 0 1 2 3 4 5 6 7 8 9 10 e f f ( % ) 12 v 24 v inductor : cyntec pcmb 135 t - 3 r 3 mf high - side mosfet : irf 7811 low - side mosfet : irf 7832 frequency 360 khz efciency vs load - 12v output 20 % 30 % 40 % 50 % 60 % 70 % 80 % 90 % 100 % 0 1 2 3 4 5 6 e f f ( % ) i out ( adc ) 18 v 24 v inductor : cyntec pcmb 104 e - 4 r 7 ms high - side mosfet : irf 7811 low - side mosfet : irf 7832 frequency 400 khz load regulation power save mode 1 . 75 1 . 76 1 . 77 1 . 78 1 . 79 1 . 80 1 . 81 1 . 82 1 . 83 1 . 84 1 . 85 0 1 2 3 4 5 6 7 8 9 10 i out ( adc ) v o u t ( v ) 12 v 24 v 6 v typical characteristics internalf5vfldofbias,fpsvfenabled internalf5vfldofbias,ffcmfenabled externalf5vfbias,fpsvfenabled externalf5vfbias,ffcmfenabled externalf5vfbias,fpsvfenabled externalf5vfbias,ffcmfenabled SC461 8 characteristicsfinfthisfsectionfarefbasedfonfusingfthefdetailedfapplicationfcircuit. startup into pre-bias output time (2ms/div) externalf5vfbias,fv in f=f12v,floadf20ma,fpsvfenabled start-up ss ramp-up time (2ms/div) start-up en input automatic restart v in transient ssf f (5v/div) vout f f(1v/div) vin (10v/div) time (40ms/div) over-current response time (100s/div) externalf5vfbias,fv in f=f12v,floadf17a pgood f (5v/div) load f (10a/div) vout f(1v/div) lx f (10v/div) automatic restart over-current time (20ms/div) ssf f (5v/div) lx f (10v/div) load f (10a/div) vout f f(1v/div) typical characteristics (continued) externalf5vfbias,fv in f=f12v,floadf1a externalf5vfbias,fv in f=f12v,fnofload,fpsvfenabled externalf5vfbias,fv in f=f12v,floadfresistancef50m?fcontinuous pgood f (5v/div) lx (10v/div) vout (1v/div) en f(5v/div) externalf5vfbias,fv in f=f12v,fnofload,fpsvfenabled enf f (5v/div) pgood f (5v/div) vout f(1v/div) lx f (10v/div) ssf f (5v/div) pgood f (5v/div) vout f(1v/div) lx f (10v/div) time (2ms/div) lx (10v/div) SC461 9 characteristicsfinfthisfsectionfarefbasedfonfusingfthefdetailedfapplicationfcircuit. switching forced continuous mode time ( 10s/div) externalf5vfbias,fv in f=f12v,floadf10a,ffcmfenabled switching power-save mode, light load time (10s/div) switching power-save mode, no load output shutdown vout f f (1v/div) pgood f (5v/div) lxf f (10v/div) time (400s/div) transient response power-save mode time (100s/div) externalf5vfbias,fv in f=f12v,fv out f=f1.8v,fload ff 0aftof10a,fpsvfenabled voutf f (50mv/div) fb f (50mv/div) load f(10a/div) lx f (10v/div) transient response forced continuous mode time (100s/div) voutf f (50mv/div) fb f (50mv/div) lxf f (10v/div) load f f(10a/div) typical characteristics (continued) externalf5vfbias,fv in f=f12v,fv out f=f1.8v,fload ff 1a externalf5vfbias,fv in f=f12v,floadf1a,fpsvfenabled externalf5vfbias,fv in f=f12v,fv out f=f1.8v,fload ff 0aftof10a,ffcmfenabled externalf5vfbias,fv in f=f12v,fnofload,fpsvfenabled dl f (5v/div) vout f(50mv/div) lx f (10v/div) vout f(50mv/div) dl f (5v/div) lx f (10v/div) time (10ms/div) vout f(50mv/div) dl f (5v/div) lx f (10v/div) en f f (5v/div) SC461 10 rlim 100 nf 0 w 100 n f sc 461 t o n vldo vout dl vdda pgood e n l b s t psv e n vddp a g n d fb d h n / c vin l x s s i l i m pgnd q 1 en pgood enable ldo 5 v vin vin q 2 rtop l 1 rbot 1 f 5 v vout rton 1 f vldo 1 2 3 ( 1 ) 4 5 11 12 13 14 15 6 7 8 9 10 20 19 18 17 16 cout + 1 f 154 k w 12 v to 1 . 8 v @ 10 a ctop * pad 19 . 6 k w 10 k w np cin 1 cin 2 100 n f component value manufacturer part number web cin 1 , cin 2 10 f / 25 v murata grm 32 dr 71 e 106 ka 12 l www . murata . com edc . sanyo . com cout 2 x 220 f / 15 m w / 4 v sanyo 4 tpe 220 mf www . cyntec . com l 1 1 . 5 h cyntec pcmb 1335 t - 1 r 5 mf key components www . irf . com q 1 irf 7821 i . r . irf 7821 www . irf . com q 2 irf 7832 i . r . irf 7832 6 . 81 k w css 3 . 3 nf cbst ( 1 ) ( 2 ) psv : remove 0 w resistor for power - save operation . connect 0 w resistor from psv pin to vdda for forced continuous mode operation . ( 1 ) 5 v : connect vdda and vddp to external 5 v supply for external bias . connect vdda and vddp to vldo for self - biased operation . notes : ( 2 ) detailed application circuit SC461 11 pin descriptions pin # pin name pin function 1 fb feedbackfinputfforfswitchingfregulatorffconnectftofanfexternalfresistorfdividerffromfoutputffusedftofpro - gramfthefoutputfvoltage. 2 vout switcherfoutputfvoltagefsensefpin.ffthefvoltagefatfthisfpinfmustfnotfexceedfthefvddafpin.ffforfoutputfvoltagesf upftofvddafconnectfthisfpinfdirectlyftofthefswitcherfoutput.ffforfoutputfvoltagesfexceedingf5vfconnectfthisf pinftofthefswitcherfoutputfthroughfafresistorfdivider.ff 3 vdda supplyf inputf forf internalf analogf circuitsf f f connectf tof anf externalf 3.3vf orf 5vf supplyf orf connectf tofvldof falsofthefsensefinputfforfvddafunderfvoltageflockoutf(vddafuvlo). 4 vldo outputfoffthef5vfldoffthefvoltagefatfthisfpinfmustfnotfexceedfthefvoltagefatfthefvddafpin. 5 vin inputfsupplyfvoltageffconnectftofthefsamefsupplyfusedfforfthefhigh-sidefmosfet.ffconnectfaf100nffcapaci - torffromfthisfpinftofagndftofflterfhighffrequencyfnoise. 6 ss soft-startfffconnectfanfexternalfcapacitorftofagndftofprogramfthefsoft-startfandfautomaticfrecoveryftime. 7 nc nofconnection 8 bst bootstrapfpinffconnectfaf100nffminimumfcapacitorffromfbstftoflxftofdevelopftheffoatingfvoltagefforfthef high-sidefgatefdrive.ff 9 dh high-sidefgatefdrivefoutput 10 lx switchingf(phase)fnode 11 pgnd powerfgroundfforfthefdlfandfdhfdriversfandftheflow-sidefexternalfmosfet. 12 dl low-sidefgatefdrivefoutput 13 vddp supplyfinputfforfthefdhfandfdlfgatefdrivesffconnectftofthefsamef3.3vforf5vfsupplyfusedfforfvdda. 14 psv power-savefprogrammingfinputfffoatfpinftofselectfpower-savefwithfnofminimumffrequencyffpullfupftof vddaftofdisablefpower-savefandfselectfforcedfcontinuousfmode. 15 pgood open-drainfpowerfgoodfindicatorffhighfimpedancefindicatesfthefswitchingfregulatorfoutputfisfgood.ffanf e xternalfpull-upfresistorfisfrequired. 16 ilim currentflimitfsensefpinffusedftofprogramfthefcurrentflimitfbyfconnectingfafresistorffromfilimftoflx. 17 en enablefinputfforfswitchingfregulatorffflogicflowfdisablesfthefswitchingfregulatorffflogicfhighfenablesfthef switchingfregulator. 18 agnd analogfground 19 ton onftimefprogrammingfinputffsetfthefon-timefbyfconnectingfthroughfafresistorftofagnd. 20 enl enablefinputfforfthefldofandfvinfuvlofinputfforfthefswitchingfregulatorffconnectfenlftofagndftofdisablef thefldofffdriveftoflogicfhighf(>1.7v)ftofenablefthefldofandfinhibitfv in fuvloffconnectftofresistorfdividerf fromfvinftofagndftofprogramfthefv in fuvlofthreshold. pad agnd analogfground SC461 12 block diagram 8 vdda uvlo soft start / automatic restart fb agnd on - time generator control & status pgood gate drive control vin ton vout zero cross detector current limit ilim enl 5 v ldo vldo bst fb comparator vdda lx en dl 5 16 20 4 2 19 1 3 15 17 10 a vddp vddp vin vdda psv 14 pgnd 11 dl 12 dh 9 vddp 13 bootstrap switch reference vin ulvo detect a = connected to pins 18 and pad dl vin to control & status vin ulvo vdda ss 6 SC461 13 synchronous buck converter thefSC461fisfafstepfdownfsynchronousfdc-dcfbuckfcon - trollerfwithfanfinternalf5vfldo.ffitfprovidesfefcientfopera - tionfinfafspacefsavingf3x3f(mm)f20-pinfpackage.ffthef programmablefoperatingffrequencyfrangefupftof1mhzf enablesfoptimizingfthefconfgurationfforfpcbfareafandf efciency.ffff thefcontrollerfusesfafpseudo-fixedffrequencyfadaptivef on-timefcontrol.ffthisfallowsffastftransientfresponsefwhichf permitsfthefusefoffsmallerfoutputfcapacitors. input voltage requirements thefSC461frequiresftwofinputfsuppliesfforfnormalfopera - tion:ffv in fandfvdda/vddp.ffv in foperatesfoverfthefwidef rangefoff3vftof28v.ffvddafandfvddpfrequirefaf3.3vforf5vf supplyfwhichfcanfbeffromfanfexternalfsourceforffromfthef internalfldo.ffvddafandfvddpfmustfbefderivedffromfthef samefsourcefvoltage.ff psuedo-fxed frequency adaptive on-time control thefpwmfcontrolfmethodfusedfbyfthefSC461fisfpseudo- f fxedffrequency,fadaptivefon-time,fasfshownfinffiguref1.f thefripplefvoltagefgeneratedfatfthefoutputfcapacitorfesrf isfusedfasfafpwmframpfsignal.ffthisfripplefisfusedftoftriggerf thefon-timefoffthefcontroller.f q 1 q 2 l c out esr + c in v out fb threshold v fb v lx v lx ton fb v in figure 1 pwm control method, v out ripple thefadaptivefon-timefisfdeterminedfbyfanfinternalfone- shotftimer.ffwhenfthefone-shotfisftriggeredfbyfthefoutputf ripple,fthefdevicefsendsfafsinglefon-timefpulseftofthefhigh- sidefmosfet.fthefpulsefdurationfisfdeterminedfbyfv outff andfv in .fthefdurationfisfproportionalftofoutputfvoltagef andfinverselyfproportionalftofinputfvoltage.ffwithfthisf adaptivefon-timefconfguration,fthefdevicefautomaticallyf anticipatesfthefon-timefneededftofregulatefv out fforfthef presentfv in fconditionfandfatfthefselectedffrequency.ff thefadvantagesfoffadaptivefon-timefcontrolfare: predictablefoperatingffrequencyfcomparedftof otherfvariableffrequencyfmethods.f reducedfcomponentfcountfbyfeliminatingfthef errorfampliferfandfcompensationfcomponents. reducedf componentf countf byf removingf thef needftofsensefandfcontrolfinductorfcurrent. fastftransientfresponseffthefresponseftimefisf controlledfbyfaffastfcomparatorfinsteadfoffaftypi - callyfslowferrorfamplifer. reducedfoutputfcapacitancefdueftoffastftran - sientfresponse. one-shot timer and operating frequency one-shotftimerfoperationfisfshownfinffiguref2.ftheffbf comparatorfoutputfgoesfhighfwhenfv fb fisflessfthanfthef internalf600mvfreference.fthisffeedsfintofthefdhfgatef drivefandfturnsfonfthefhigh-sidefmosfet,fandfalsofstartsf thefone-shotftimer.ffthefone-shotftimerfusesfanfinternalf comparatorfandfafcapacitor.ffonefcomparatorfinputfisfcon - nectedftofv out ,fthefotherfinputfisfconnectedftofthefcapaci - tor.ffwhenfthefon-timefbegins,fthefcapacitorfchargesffromf zerofvoltsfthroughfafcurrentfwhichfisfproportionalftofv in .f whenfthefcapacitorfvoltagefreachesfv out ,fthefon-timefisf completedfandfthefhigh-sidefmosfetfturnsfof.fff gate drives fb comparator one - shot timer on - time = k x r ton x ( v out / v in ) v out v in fb ref q 1 q 2 l c out v in esr + v out v lx fb dh dl r ton + - figure 2 on-time generation ? ? ? ? ? applications information SC461 14 thisfmethodfautomaticallyfproducesfanfon-timefthatfisf proportionalf tofv out f andf inverselyf proportionalf tofv in .ff underfsteady-statefconditions,fthefswitchingffrequencyf canfbefdeterminedffromfthefon-timefbyftheffollowingf equation. in on out sw v t v f u thefSC461fusesfanfexternalfresistorftofsetfthefon-timefwhichf indirectlyfsetsftheffrequency.ffthefon-timefcanfbefpro - grammedftofprovidefanfoperatingffrequencyfoffupftof1mhzf usingfafresistorfbetweenftheftonfpinfandfground.fthefresis - torfvaluefis selected by the following equation. 2 8 7 , 1 6 : , 1 2 8 7 2 8 7 , 1 2 1 7 2 1 9 s ) 9 q v i 9 9 9 s ) 9 q v 7 5 u u ? ? 1 ? u u u thefmaximumfrecommendedfr ton fvaluefisfshownfbyfthef followingfequation. $ 9 5 , 1 b 0 , 1 7 2 1 b 0 $ ; u immediatelyfafterfthefon-time,fthefdlfoutputfdrivesfhighf tofenergizeftheflow-sidefmosfet.ffdlfhasfafminimumfhighf timefoff~250ns,fafterfwhichfdlfcontinuesftofstayfhighfuntilf onefofftheffollowingfoccurs:f theffbfinputffallsfbelowfthef600mvfreference thefzerofcrossfdetectorftripsfiffpower-savefisf active ton limitations and vdda supply voltage forfvddafbelowf4.5v,ftheftonfaccuracyfmayfbeflimitedfbyf v in .ffthefpreviousfrtonfequationfisfaccuratefiffv in fsatisfesf thefbelowfrelationfoverfthefentirefv in frange: v in < (vdda - 1.6v) x 10 iff v in fexceedsf((vddaf-f1.6v)fxf10)fforfallforfpartfoffthef v in f range,fthefpreviousfrtonfequationfisfnotfaccurate.finfallf casesfwherefvinf>f((vddaf-f1.6v)fxf10),fthefrtonfequationf mustfbefmodifedfasffollows.f ? ? 2 8 7 2 1 7 2 1 9 s ) 9 9 ' ' $ q v 7 5 u u u notefthatfwhenf v in fisfgreaterfthanff((vddaf-f1.6v)fxf10),fthef actualfon-timefisffxedfandfdoesfnotfvaryfwithfv in .ffwhenf operatingfinfthisfcondition,fthefswitchingffrequencyfwillf varyfinverselyfwithfv in fratherfthanfapproximatingffxedf frequency. v out voltage selection thefswitcherfoutputfvoltagefisfregulatedfbyfcomparingf v out fasfseenfthroughfafresistorfdividerfatftheffbfpinftofthef internalf600mvfreferencefvoltagef(seeffiguref3).f r 1 to fb pin r 2 v out figure 3 output voltage selection notefthatfthisfcontrolfmethodfregulatesfthefvalleyfoffthef outputfripplefvoltage,fnotfthefdcfvalue.ffthefdcfvaluefoff v out fisfofsetfbyfthefoutputfripplefaccordingftoftheffollow - ingfequation. ? 1 ? ? ? 1 ? u 2 v r r 1 0.6 v ripple 2 1 out infsomefapplicationsfafsmallfcapacitorfc top fisfplacedfinf parallelfwithfr1ftofprovidefaflargerfripplefsignalffromfv out f toftheffbfpin.ffinfthesefapplications,fthefoutputfvoltagef v out fisfcalculatedfaccordingftoftheffollowingfequationfinf whichf z frepresentsfthefswitchingffrequency. 7 2 3 7 2 3 5 , 3 3 / ( 2 8 7 & & 5 5 5 5 & & 5 9 5 5 9 ? ? 1 ? u u ? 1 ? ? ? 1 ? u confguring v out greater than 5v thefswitcherfoutputfvoltagefcanfbefprogrammedfhigherf thanf5vfwithfcarefulfattentionftofthefvoutfandfrtonfpins.ff infthesefapplicationsfthefvoutfpinfcannotfconnectfdirectlyf applications information (continued) SC461 15 tofthefswitcherfoutputfdueftofitsfmaximumfvoltagefrating.ff anf additionalf resistorf dividerf networkf isf requiredf tof connectffromfthefswitcherfoutputftofthefvoutfpinfasf shownfinffiguref4. to vout pin vout > 5 v r v 1 cout l lx r v 2 figure 4 resistor divider for v out exceeding 5v thefresistorsfmustfbefchosenfsofthatfthefvoutfdoesfnotf exceedfthefvddafsupply.ffnotefthatfthefvoutfpinfhasfanf internalf500k w fresistorfconnectedftofagnd.fftofminimizef thefefectfoffthisfresistorfonfthefresistorfdividerfratio,fthef maximumfrecommendfvaluefforfresistorfr v2 finffiguref4fisf 10k w .ff infadditionftofthefresistorfdivider,fthefrtonfresistorfvaluef mustfbefadjusted.ffthefon-timefisfcalculatedfaccordingftof thefvoltagefatfthefvoutfpin.ffinforderftofselectfthefdesiredf on-timef andf operatingf frequency,f thef rtonf resistorf shouldfbefadjustedftofafhigherfvalueftofcompensatefforf thefreducedfvoltagefatfthefvoutfpin.ffforfoutputfvoltagesf exceedingf5v,fthefrequiredfrtonfvaluefcanfbefdeterminedf byftheffollowingfequation.f ? ? 1 ? u u u ? ? 1 ? u 9 9 2 8 7 , 1 6 : , 1 2 8 7 7 2 1 5 5 9 s ) 9 q v i 9 9 5 forfapplicationsfwherefv out fexceedsf5v,ffcmfoperationfisf recommended.ff forced continuous mode operation thefSC461foperatesfthefswitcherfinfforcedfcontinuousf modef(fcm)fbyfconnectingfthefpsvfpinftofvdda.ffthefpsvf pinfshouldfneverfexceedfthefvddafsupply.ffseeffiguref5f forf fcmf waveforms.f f inf thisf modef onef off thef powerf mosfetsfisfalwaysfon,fwithfnofintentionalfdeadftimefotherf thanf tof avoidf cross-conduction.f fthisf resultsf inf moref uniformffrequencyfacrossftheffullfloadfrange,fwithfthef trade-offbeingfreducedfefciencyfatflightfloadsfdueftof thefhigh-frequencyfswitchingfoffthefmosfets. thefpsvfpinfcontainsfaf5afcurrentfsinkftofpreventfstrayf leakagefcurrentffromfpullingfthefpsvfpinfupftofthefvddaf supplyfwhenfthefpsvfpinfisffoatedftofselectfpower-savef operation.fftofselectfforcedfcontinuousfmodefoperation,f thef maximumf recommendedf resistancef betweenf thef vddafsupplyfandfthefpsvfpinfisf40k w . ff ff fb ripple voltage ( v fb ) fb threshold dl dh inductor current dc load current dh on - time is triggered when v fb reaches the fb threshold . on - time ( t on ) dl drives high when on - time is completed . dl remains high until v fb falls to the fb threshold . figure 5 forced continuous mode operation power-save mode operation thefSC461fprovidesfpower-savefoperationfatflightfloadsf withfnofminimumfoperatingffrequency,fselectedfbyffoat - ingfthefpsvfpinf(nofconnection).ffinfthisfmodefoffopera - tion,fthefzerofcrossfcomparatorfmonitorsfinductorfcurrentf viafthefvoltagefacrossftheflow-sidefmosfetfduringfthef of-time.fiffthefinductorfcurrentffallsftofzerofforf8fconsecu - tivefswitchingfcycles,fthefcontrollerfentersfpower-savef operation.fitfwillfthenfturnfofftheflow-sidefmosfetfonf eachfsubsequentfcycle,fprovidedfthatfthefcurrentffallsftof zero.ffafterftheflow-sidefmosfetfisfof,fbothfhigh-sidefandf low-sidesfmosfetsfremainfoffuntilfv fb fdropsftofthef600mvf threshold.ffwhilefthefmosfetsfarefoffthefloadfisfsuppliedf applications information (continued) SC461 16 byfthefoutputfcapacitor.ffiffthefinductorfcurrentfdoesfnotf reachfzerofonfanyfswitchingfcycle,fthefcontrollerfimmedi - atelyfexitsfpower-savefandfreturnsftofforcedfcontinuousf mode.f figuref 6f showsf power-savef operationf atf lightf loads.f fb ripple voltage ( v fb ) fb threshold dl dh inductor current zero ( 0 a ) dh on - time is triggered when v fb reaches the fb threshold . on - time ( t on ) dl drives high when on - time is completed . dl remains high until inductor current reaches zero . dead time varies according to load figure 6 power-save operation smart power-save protection activefloadsfmayfleakfcurrentffromfafhigherfvoltagefintof thefswitcherfoutput.ffunderflightfloadfconditionsfwithf power-savefenabled,fthisfcanfforcefv out ftofslowlyfrisefandf reachfthefover-voltagefthreshold,fresultingfinfanfover- voltagefshutdown.fsmartfpower-savefpreventsfthisfcondi - tion.fwhenftheffbfvoltagefexceedsf10%fabovefnominalf (exceedsf660mv),fthefdevicefimmediatelyfdisablesfpower- savefandfdlfdrivesfhighftofturnfonftheflow-sidefmosfet.ff thisfdrawsfcurrentffromfv out fthroughfthefinductorfandf causesfv out ftoffall.ffwhenfv fb fdropsfbackftofthef600mvftripf point,fafnormalft on fswitchingfcyclefbegins.fthisfmethodf preventsfover-voltagefshutdownfbyfcyclingfenergyffromf v out fbackftofv in .ffitfalsofminimizesfoperatingfpowerfunderf lightfloadfconditionsfbyfavoidingfforcedfcontinuousffmodef operation.f figuref7fshowsftypicalfwaveformsfforfthefsmartfpower- saveffeature. fb threshold high - side drive ( dh ) low - side drive ( dl ) v out drifts up to due to leakage current flowing into c out dh and dl off dl turns on when smart psave threshold is reached smart power save threshold dl turns off when fb threshold is reached single dh on - time pulse after dl turn - off v out discharges via inductor and low - side mosfet normal dl pulse after dh on - time pulse normal v out ripple figure 7 smart power-save smartdrive tm forfeachfdhfpulse,fthefdhfdriverfinitiallyfturnsfonfthef high-sidefmosfetfatfafslowerfspeed,fallowingfafsofter,f smoothfturn-offofftheflow-sidefdiode.foncefthefdiodefisf offfandftheflxfvoltagefhasfrisenf0.8vfabovefpgnd,fthef smartdrivef circuitf automaticallyf drivesf thef high-sidef mosfetfonfatfafrapidfrate.ffthisftechniquefreducesfswitch - ingfnoisefwhilefmaintainingfhighfefciency,freducingfthef needfforfsnubbers. enablefinputfforfswitchingfregulator thef enf inputf isf af logicf levelf input.f f whenf enf isf lowf (grounded),fthefswitchingfregulatorfisfoffandfinfitsflowestf powerfstate.ffwhenfenfisflowfandfvddafisfabovefthefvddaf uvlof threshold,f thef outputf off thef switchingf regulatorf soft-dischargesf intof thef voutf pinf throughf anf internalf 2k?fresistor.ffwhenfenfisfaflogicfhighf( > 1v)fthefswitchingf regulatorfisfenabled.f thef enf inputf hasf internalf resistorsf f 2m ? f pullupf tof vdda,fandfaf1m ? fpulldownftofagnd.ffthesefresistorsfwillf normallyfcausefthefenfvoltageftofbefnearftheflogicfhighf tripf pointf asf vddaf reachesf thef vddaf uvlof threshold.ff tofpreventfundesiredftogglingfoffenfandferraticfstart-upf performance,fthefenfpinfshouldfnotfbefallowedftoffoatfasf open-circuit.ff applications information (continued) SC461 17 notefthatfthefldofenablefpinf(enl)fcanfalsofdisablefthef switchingfregulatorfthroughfthefv in fuvloffunction.ffreferf tofthefenlfpinfandfv in fuvlofsection.ff current limit protection thefSC461ffeaturesfprogrammablefcurrentflimiting,fwhichf isfaccomplishedfusingfthefrds (on) fofftheflowerfmosfetfforf currentfsensing.ffthefcurrentflimitfisfsetfbyfr lim fresistorf whichfconnectsffromfthefilimfpinftofthefdrainfofftheflow- sidefmosfet.ffwhenftheflow-sidefmosfetfisfon,fanfinternalf 10 afcurrentffowsffromfthefilimfpinfandfthroughfthefr lim f resistor,fcreatingfafvoltagefdropfacrossfthefresistor.ffwhilef theflow-sidefmosfetfisfon,fthefinductorfcurrentfflowsf throughfitfandfcreatesfafvoltagefacrossfthefrds (on) .fthef voltagefacrossfthefmosfetfisfnegativefwithfrespectftof pgnd.ffiffthisfmosfetfvoltagefdropfexceedsfthefvoltagef acrossfr lim ,fthefvoltagefatfthefilimfpinfwillfbefnegativefandf currentflimitfwillfactivate.fthefcurrentflimitfthenfkeepsfthef low-sidefmosfetfonfandfpreventsfanotherfhigh-sidefon- time,funtilfthefcurrentfinftheflow-sidefmosfetfreducesf enoughftofbringfthefilimfpinfvoltagefupftofzero.ffthisf methodfregulatesfthefinductorfvalleyfcurrentfatftheflevelf shownfbyfi lim finffiguref8. time i peak i load i lim i n d u c t o r c u r r e n t figure 8 valley current limit thefcurrentflimitfschematicfwithfthefr lim fresistorfisfshownf inffiguref9. v out v in + cin q 2 + d 2 r lim c bst q 1 l pgnd dl ilim lx dh bst c out figure 9 valley current limit settingfthefvalleyfcurrentflimitftof10afresultsfinfafpeakf inductorfcurrentfoff10afplusfpeakfripplefcurrent.finfthisf situationfthefaveragefcurrentfthroughfthefinductorfisf10af plusfone-halffthefpeak-to-peakfripplefcurrent. thefr lim fvaluefisfcalculatedfbyfthefnextfequation. $ , 5 ' 6 5 / , 0 2 1 / , 0 u fff thefinternalf10afcurrentfsourcefisftemperaturefcompen - satedfatf2800fppmfinforderftofprovideftrackingfwithfthef rds on . soft-start of pwm regulator thefSC461fhasfafprogrammablefsoft-startftimefthatfisfcon - trolledfbyfanfexternalfcapacitorfatfthefssfpin.fduringfthef soft-startftime,fthefcontrollerfsourcesf3affromfthefssfpinf tof chargef thef capacitor.f duringf thef start-upf processf (figuref10),f40%ffoffthefvoltageframpfatfthefssfpinfisfusedf asfthefreferencefforftheffbfcomparator.fthefpwmfcompara - torfissuesfanfon-timefpulsefwhenftheffbfvoltagefisflessf thanf 40%f off thef ssf voltage,f whichf forcesf thef outputf voltageftoffollowfthefssframp.fthefoutputfvoltagefreachesf regulationfwhenfthefssfpinfvoltagefexceedsf1.5vfandfthef fbfreachesfthef600mvfthreshold.fftheftimefbetweenfthef frstflxfpulsefandfvoutfreachingfthefregulationfpointfisf thefsoft-startftimef(t ss ).fthefcalculationfforfthefsoft-startf timefisfshownfbyftheffollowingfequation. applications information (continued) SC461 18 a 3 v 5 . 1 c t ss ss p u afterfthefssfcapacitorfvoltagefreachesf1.5v,fthefssfcapaci - torfcontinuesftofchargefuntilfthefssfvoltagefisfequalftof 67%foffvdda.fatfthisftimefthefpowerfgoodfmonitorfcom - paresftheffbfpinfandfsetsfthefpgoodfoutputfhighf(openf drain)fiffvoutfisfinfregulation.fftheftimefbetweenfvoutf reachingfthefregulationfpointfandfthefpgoodfoutputf goingfhighfisfshownfbyftheffollowingfequation. ? 1 ? u u 9 9 ' ' $ $ & w 6 6 3 * 2 2 ' theftimeffromfthefrisingfedgefoffthefenfpinfftofthefpgoodf outputfgoingfhighfisfshownfbyftheffollowingfequation. ? 1 ? u u 9 ' ' $ $ & w 6 6 ( 1 b 3 * 2 2 ' afterfthefpowerfgoodfstart-upfdelayftimefisfcompleted,f thefssfpinfisfinternallyfpulledfupftofthefvddafsupply. thefsoft-startfcyclefandfpowerfgoodftimingfcanfbefseenfinf theffiguref10.ff en ss fb pgood css charging current 3 ua v ss = 1 . 5 v vout in regulation v ss = 67 % vdda t ss t pgood figure 10 soft-start cycle and power good timing pre-bias start-up SC461fcanfsupportfsoft-startfwithfanfoutputfpre-bias.fthef ssfcapacitorframpftimefisfthefsamefasfafnormalfstart-upf whenfthefoutputfvoltagefstartsffromfzero.funderfafpre- biasfstart-up,fthefdhfandfdlfdriversfinhibitfswitchingfuntilf 40%f off thef rampf atf thef ssf pinf equalsf thef pre-biasf fbf voltageflevel.fpre-biasfstart-upfisfachievedfbyfturningfoff theflowerfmosfetfwhenfthefinductorfcurrentfreachesfzerof duringfthefsoft-startfcycle.fthisfmethodfhelpsfpreventfthef outputfvoltageffromfdecreasing. power good output thefpgoodf(powerfgood)foutputfisfanfopen-drainfoutputf whichfrequiresfafpull-upfresistor.ffduringfstart-up,fpgoodf isfheldflowfandfisfnotfallowedftoftransitionfhighfuntilfthef outputfvoltagefisfinfregulationfandfthefssfpinfhasfreachedf 67%foffvdda.fftheftimeffromfenfgoingfhighftofpgoodf goingfhighfisftypicallyf12.5msfforfcssf=f10nffandfvddaf=f 5v.ffffforfcssf=f10nffandfvddaf=f3vftheftypicalfpgoodf timefisf7.5ms. whenfthefvoltagefatftheffbfpinfisf10%fbelowfthefnominalf voltage,fpgoodfisfpulledflow.foncefpgoodfpullsflowf therefisftypicallyf2%fhysteresisftofpreventfchatterfonfthef pgoodfoutput.fff pgoodfwillftransitionflowfifftheffbfvoltagefexceedsf+20%f offnominalf(720mv),fwhichfisfalsofthefover-voltagefshut - downfthreshold.fpgoodfalsofpullsflowfiffthefenfpinfisflowf andfvddafisfpresent.ff output over-voltage protection over-voltagefprotectionf(ovp)fbecomesfactivefasfsoonfasf thefdevicefisfenabled.fthefovpfthresholdfisfsetfatf600mvf +f20%f(720mv).fftherefisfaf5sfdelayfbuiltfintofthefovpf detectorftofpreventffalseftransitions.fwhenfv fb fexceedsfthef ovpfthreshold,fdlfisfdrivenfhighfandftheflow-sidefmosfetf isfturnedfon.fdlfremainsfhighfandfthefcontrollerfremainsf of.ffifftheffbfpinfremainsfabovefthefovpfthreshold,fdlf remainsfhighfandftheficfwillfmaintainfthisfmaintainfthisf statefwithfnofautomaticfrecovery.ffifffbffallsfbelowfthefovpf threshold,fthefdevicefgoesfthroughfthefautomaticffaultf recoveryfcycle.ffwhenfthefautomaticfrecoveryfcyclefisf completed,fthefdevicefwillfattemptfafnewfsoft-startfcycle.ff atfthefstartfoffthefsoft-startfcycle,fthefdlfoutputfwillfgof lowfforftypicallyf30usfwhilefthefcontrollerfinitializesfthef applications information (continued) SC461 19 soft-startf sequence.f f pgoodf isf alsof lowf afterf anf ovpf event. output under-voltage protection whenfv fb ffallsf25%fbelowfitsfnominalfvoltagef(fallsftof 450mv)fforfeightfconsecutivefclockfcycles,fthefswitcherfisf shutfoffandfthefdhfandfdlfdrivesfarefpulledflowftoftri- statef thef mosfets.fthef controllerf staysf offf whilef thef devicefgoesfthroughfthefautomaticffaultfrecoveryfcycle. automatic fault recovery thefSC461fincludesfanfautomaticfrecoveryffeaturef(hiccupf modefuponffault).ffiffthefswitcherfoutputfisfshutfdownfduef tofaffaultfcondition,fthefdevicefusesfthefssfcapacitorfasfaf timer.ffuponffaultfdetectionfthefssfpinfisfpulledflowfandf thenfbeginsfchargingfthroughfthefinternalf3 afcurrentf source.ffwhenfthefssfcapacitorfreachesf67%foffvdda,fthef ssfpinfisfagainfpulledflow,fafterfwhichfthefssfcapacitorf beginsfanotherfchargingfcycle.ffthefssfcapacitorfwillfbef usedfforf15fcyclesfoffchargingffromf0ftof67%foffvdda.ff(forf over-voltagefandfover-temperatureffaults,fthefcountfwillf bef 16f cyclesf insteadf off 15).f f duringf thesef cyclesf thef switcherfisfoffandftherefisfnofmosfetfswitching.ff duringf thef nextf chargingf cycle,f thef normalf soft-startf routinefisfimplementedfandfthefmosfetsfbeginfswitch - ing.ffswitchingfcontinuesfuntilfthefpowerfgoodfstart-upf delayftimefisfreached.ffiffthefswitcherfoutputfisfstillfinfaf faultfcondition,fthefswitcherfwillfagainfshutfdownfandf forcef15fcyclesfoffssfchargingf(16fcyclesfinfthefcasefoffanf over-voltageforfover-temperatureffault)fbeforefattempt - ingfanotherfsoft-start.ffftheflongfdelayfbetweenfsoft-startf cyclesf reducesf thef averagef powerf lossf inf thef powerf components.fff thefautomaticfrecoveryftimingfisfshownfinffiguref11. 15 cycles ss t hiccup = 15 x t en _ pgood t en _ pgood 67 % x vdda 1 soft - start cycle fault applied 15 cycles 1 soft - start cycle t en _ pgood t en _ pgood t hiccup = 15 x t en _ pgood figure 11 automatic recovery timing thef controlf off thef low-sidef mosfetf duringf anf over- voltageffaultfisfhandledfdiferentlyffromfotherffaults.ffiffthef faultfwasfdueftofanfover-voltagefcondition,fthefdlfoutputf willfremainfhighfduringf16fssfchargingfcycles.ffforfallfotherf faults,fthefdlfoutputfwillfremainflow.ffhowever,fifftheffbf pinfexceedsfthefover-voltagefthreshold,fthefchargingfoff thefssfcapacitorfwillfnotfoccur,fandfthefdlfoutputfwillf remainfhigh.ffifftheffbfpinffallsfbelowfthefovpfthreshold,f 16fssfchargingfcyclesfwillfoccurfwhilefdlfremainsfhigh.ff whenfthefnextfstart-upfcyclefcommences,fdlfwillfdrivef lowfforftypicallyf30usfasfthefcontrollerfre-initializesfthef internalfsoft-startfroutine.f vdda uvlo and por thefvddafunder-voltageflock-outf(uvlo)fcircuitryfinhib - itsfswitchingfandftri-statesfthefdh/dlfdriversfuntilfvddaf risesfabovef2.84v.ffwhenfvddafexceedsf2.84v,fanfinternalf porf(power-onfreset)fresetsftheffaultflatchfandfthefsoft- startfcircuitryfandfthenfthefSC461fisfreadyftofbeginfafsoft- startfcycle.fthefswitcherfwillfshutfoffiffvddaffallsfbelowf 2.62v.fffvddpfdoesfnotfhavefuvlofprotection. ldo regulator whenfthefldofisfprovidingfbiasfpowerftofthefdevice,faf minimumf0.1ffcapacitorfreferencedftofagndfisfrequired,f alongfwithfafminimumf1ffcapacitorfreferencedftofpgndf tofflterfthefgatefdrivefpulses.ffreferftofthefpcbflayoutf guidelinesfsection.fff enl pin and v in uvlo thefenlfpinfisfalsofusedfforfthefv in funder-voltageflockoutf (v in fuvlo)fforfthefswitcher.ffthefv in fuvlofvoltagefisfpro - grammablefviafafresistorfdividerfatfthefv in ,fenlfandfagndf pins.ffthefv in fuvloffunctionfhasfaftypicalfthresholdfoff1.55vf onfthefv inf risingfedge.fftheffallingfedgefthresholdfisf1.24v. notefthatfwhenfthefv in fuvloffeaturefisfused,fthefldofisf enabledfbecausefthefenlfpinfisfabovefthefldofenablef thresholdf(0.8vftypical).ffinfthesefcasesfthefSC461fmustfusef thefinternalfldofforfbiasfpower.f timingfisfimportantfwhenfdrivingfenlfwithflogicfandfnotf usingfthefv in fuvlofcapability.ffthefenlfpinfmustftransitionf fromfhighftoflowfwithinf2fswitchingfcyclesftofavoidfthef pwmfoutputfturningfof.ffiffenlfgoesfbelowfthefv in fuvlof applications information (continued) SC461 20 applications information (continued) thresholdfandfstaysfabovef1v,fthenfthefswitcherfwillfturnf offbutfthefldofwillfremainfon. notefthatfitfisfpossibleftofoperatefthefswitcherfwithfthef ldofdisabled,fbutfthefenlfpinfmustfbefbelowftheflogicf lowfthresholdf(0.4vfmaximum),fotherwisefthefv in fuvlof functionfwillfdisablefthefswitcher. thefnextftablefsummarizesftheffunctionfoffthefenlfandfenf pins.ff en enl ldo status switcher status low low,f SC461 21 applications information (continued) whenfthefldofisfusedfasfbiasfpowerfforfthefdevice,fthefenf andfenlfinputsfmustfbefusedfcarefully.ffdofnotfconnectf thefenfpinfdirectlyftofvddaforfanotherfsupplyfvoltage.ffiff thisfisfdone,fdrivingfthefenlfpinflowf(tofagnd)fwillfturnfoff thef ldof andf thef ldof switch-overf mosfet,f butf thef switcherfcanfcontinuefoperating.ffiffv out fexceedsf2.5v,fthef outputfvoltagefcanffeedfintofthefvddafsuppliesfthroughf internalfparasiticfdiodesfviafthefvoutfpin.ffthisfcanfpoten - tiallyfdamagefthefdevice,fandfalsofcanfpreventfthefswitcherf fromfshuttingfoffuntilfthefvddafsupplyfdropsfbelowfthef vddafuvlofthreshold.ffforfthesefapplicationsfafdedicatedf logicfsignalfisfrequiredftofdrivefenflowfandfdisablefthef switcher.ffthisfsignalfcanfbefcombinedfwithfthefenlfsignalf iffneeded,fasflongfasfthefenfpinfdoesfnotfexceedfabsolutef maximumfratings. ldo usage at low input voltage applicationsfrequiringfsteady-stateforftransientfoperationf atflowfinputfvoltagesf(v in fbelowf6.5v)fmayfusefthefinternalf ldoftofbiasfthefvdda/vddpfpinsfwithinflimitations.fftheref areflimitationsftofbothfstartupfandfnormalfoperationfasf explainedfbelow. whenfstartingfupfusingfthefinternalfldo,fswitcherfopera - tionfisfinhibitedfuntilfthefldofoutputfreachesf4v.ffduringf thisftime,fthefldofstart-upfisfimplementedfusingfafcurrentf source.ffatflowfv in fitfisfimportantftofnotfapplyfanfexternalf loadftofthefldo,finforderftofallowfthefldofoutputftofreachf thef4vfthresholdfandfallowfswitchingftofbegin.f oncefswitchingfbegins,fldofoperationftransitionsffromf current-sourcef operationf tof voltagef regulation.f fthef minimumfoperatingfv in fisfthenflimitedfbyfthefrds on foffthef internalfldofmosfet.ffthefcurrentfrequiredftofpowerfthef SC461fandfexternalfmosfetfgatesfcausesfafvoltagefdropf fromfthefv in fpinftofthefvldofpin.ffthefvldofpinfmustfstayf abovef4v,fotherwisefthefldofcontrolfwillfrevertfbackftof current-sourcefoperation,fcausingfmorefvoltagefdropfatf thefldofoutput.ffthefrds on foffthefldofmosfetfatflowfv in f isftypicallyf28fohmsfatf25c. design procedure whenfdesigningfafswitchfmodefsupplyfthefinputfvoltagef range,f loadf current,f switchingf frequency,f andf inductorf ripplefcurrentfmustfbefspecifed. thefmaximumfinputfvoltagef(v inmax )fisfthefhighestfspecifedf inputfvoltage.fthefminimumfinputfvoltagef(fv inmin )fisfdeter - minedfbyftheflowestfinputfvoltagefincludingfthefvoltagef dropsfdueftofconnectors,ffuses,fswitches,fandfpcbftraces. theffollowingfparametersfdefnefthefdesign. nominalfoutputfvoltagef(v out ) staticforfdcfoutputftolerance transientfresponse maximumfloadfcurrentf(i out ) therefareftwofvaluesfoffloadfcurrentftofevaluateffcon - tinuousfloadfcurrentfandfpeakfloadfcurrent.fcontinuousf loadf currentf relatesf tof thermalf stressesf whichf drivef thef selectionfoffthefinductorfandfinputfcapacitors.fpeakfloadf currentfdeterminesfinstantaneousfcomponentfstressesfandf flteringfrequirementsfsuchfasfinductorfsaturation,foutputf capacitors,fandfdesignfoffthefcurrentflimitfcircuit. theffollowingfvaluesfarefusedfinfthisfdesign. v in f=f24vf + f10% v out f=f1.8vf + f4% f sw f=f220khz loadf=f10afmaximum frequency selection selectionfoffthefswitchingffrequencyfrequiresfmakingfaf trade-offbetweenfthefsizefandfcostfoffthefexternalfflterf componentsf (inductorf andf outputf capacitor)f andf thef powerfconversionfefciency.ff thefdesiredfswitchingffrequencyfisf220khz.ff afresistor,fr ton fisfusedftofprogramfthefon-timef(indirectlyf settingftheffrequency)fusingftheffollowingfequation. 2 8 7 , 1 6 : , 1 2 8 7 2 8 7 , 1 2 1 7 2 1 9 s ) 9 q v i 9 9 9 s ) 9 q v 7 5 u u ? ? 1 ? u u u tofselectfr ton ,fusefthefmaximumfvaluefforfv in ,fandfforft on f usefthefvaluefassociatedfwithfmaximumfv in . ? ? ? ? ? ? ? ? SC461 22 applications information (continued) sw inmax out on f v v t u t on = 310 nsec at 26.4v in , 1.8v out , 220khz substitutingfforfr ton fresultsfinftheffollowingfsolution. r ton = 156k?, use r ton = 154k? inductor selection inforderftofdeterminefthefinductance,fthefripplefcurrentf mustffrstfbefdefned.fflowfinductorfvaluesfresultfinfsmallerf sizefbutfcreatefhigherfripplefcurrentfwhichfcanfreducef efciency.ffhigherfinductorfvaluesfwillfreducefthefripplef current/voltagefandfforfafgivenfdcfresistancefarefmoref efcient.ffhowever,flargerfinductanceftranslatesfdirectlyf intoflargerfpackagesfandfhigherfcost.ffcost,fsize,foutputf ripple,fandfefciencyfarefallfusedfinfthefselectionfprocess.f thefripplefcurrentfwillfalsofsetfthefboundaryfforfpower- savefoperation.fffthefswitchingfwillftypicallyfenterfpower- savefmodefwhenfthefloadfcurrentfdecreasesftof1/2foffthef ripplefcurrent.fforfexample,fiffripplefcurrentfisf4afthenf power-savefoperationfwillftypicallyfstartfforfloadsflessfthanf 2a.ffiffripplefcurrentfisfsetfatf40%foffmaximumfloadfcurrent,f thenf power-savef willf startf forf loadsf lessf thanf 20%f off maximumfcurrent. thefinductorfvaluefisftypicallyfselectedftofprovidefafripplef currentfthatfisfbetweenf25%ftof60%foffthefmaximumfloadf current.ffthisfprovidesfanfoptimalftrade-offbetweenfcost,f efciency,fandftransientfperformance. duringfthefdhfon-time,fvoltagefacrossfthefinductorfisf f (v in f-fv out ).fftheffollowingfequationfforfdeterminingfinduc - tancefisfshown.f ripple on out in i t ) v v ( l u infthisfexamplefthefinductorfripplefcurrentfisfsetfapproxi - matelyfequalftof50%foffthefmaximumfloadfcurrent.ffthusf ripplefcurrentftargetfwillfbef50%fxf10aforf5a.f ftoffndfthefminimumfinductancefneeded,fusefthefv in fandf t on fvaluesfthatfcorrespondftofv inmax .f + $ q v / u afslightlyfsmallerfvaluefoff1.5hfisfselected.f notefthatfthefinductorfmustfbefratedfforfthefmaximumfdcf loadfcurrentfplusf1/2foffthefripplefcurrent. thefripplefcurrentfunderfminimumfv in fconditionsfisfalsof checkedfusingftheffollowingfequations. q v q v 9 9 5 s ) 7 , 1 0 , 1 2 8 7 7 2 1 2 1 b 9 , 1 0 , 1 u u l t ) v v ( i on out in ripple u $ + q v , 0 , 1 5 , 3 3 / ( b 9 , 1 u capacitor selection thefoutputfcapacitorsfarefchosenfbasedfonfrequiredfesrf andfcapacitance.ffthefmaximumfesrfrequirementfisfcon - trolledfbyfthefoutputfripplefrequirementfandfthefdcftoler - ance.fthefoutputfvoltagefhasfafdcfvaluefthatfisfequalftof thefvalleyfoffthefoutputfripplefplusf1/2foffthefpeak-to-peakf ripple.ffchangefinfthefoutputfripplefvoltagefwillfleadftofaf changefinfdcfvoltagefatfthefoutput.ff thefdesignfgoalfisfforfthefoutputfvoltagefregulationftofbef 4%funderfstaticfconditions.ffthefinternalf600mvfrefer - enceftolerancefisf1%.fallowingf1%ftoleranceffromftheffbf resistorfdivider,fthisfallowsf2%ftolerancefdueftofv out fripple.ff sincefthisf2%ferrorfcomesffromf1/2foffthefripplefvoltage,f thefallowablefripplefisf4%,forf72mvfforfaf1.8vfoutput. thefmaximumfripplefcurrentfoff5afcreatesfafripplefvoltagef acrossfthefesr.ffthefmaximumfesrfvaluefallowedfisfshownf byftheffollowingfequations. $ p 9 , 9 ( 6 5 5 , 3 3 / ( 0 $ ; 5 , 3 3 / ( 0 $ ; esr max = 14.4 m? thef outputf capacitancef isf chosenf tof meetf transientf requirements.fafworst-casefloadfrelease,ffromfmaximumf SC461 23 applications information (continued) loadf tof nof loadf atf thef exactf momentf whenf inductorf currentfisfatfthefpeak,fdeterminesfthefrequiredfcapaci - tance.ffiffthefloadfreleasefisfinstantaneousf(loadfchangesf fromfmaximumftofzerofinf |